PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g28910.1.p
Common NameBRADI_2g28910, LOC100843551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 302aa    MW: 31662.5 Da    PI: 8.5004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g28910.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181863147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEd ll  av ++G ++W+ I+ +++ gR++k+c++rw + 
  Bradi2g28910.1.p 18 KGSWSPEEDSLLRAAVSRHGARNWSVISGEVP-GRSGKSCRLRWCNQ 63
                      799*****************************.***********985 PP

2Myb_DNA-binding58.71.3e-1870114147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r ++T+eEd ++v+a++q G++ W+tIar++  gRt++++k++w++ 
  Bradi2g28910.1.p  70 RRAFTPEEDAIIVEAHNQCGNK-WATIARRLV-GRTDNSVKNHWNST 114
                       678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.011364IPR017930Myb domain
SuperFamilySSF466892.68E-2916111IPR009057Homeodomain-like
SMARTSM007171.9E-151766IPR001005SANT/Myb domain
PfamPF002496.6E-181863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-241971IPR009057Homeodomain-like
CDDcd001675.29E-152062No hitNo description
PROSITE profilePS5129424.84465119IPR017930Myb domain
SMARTSM007171.2E-1569117IPR001005SANT/Myb domain
PfamPF002492.2E-1570114IPR001005SANT/Myb domain
CDDcd001672.28E-1272115No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2272118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MVPPTGPAGG ASSGGRVKGS WSPEEDSLLR AAVSRHGARN WSVISGEVPG RSGKSCRLRW  60
CNQLSPAVHR RAFTPEEDAI IVEAHNQCGN KWATIARRLV GRTDNSVKNH WNSTLRRNRR  120
AAAAAAAAGN AVLFAPPAAA ASVSSFQSLN LTEEEEEEDD DDGSDDSLPV PTKRQCVTGI  180
VPLAVKLQES PPEPDPPTSL SLSLPGVQGS SGAKVSTTPD QLASERAKLE QNPLLKAAMQ  240
QMVAEEVQRH MGSVYSALMA SLASGGGAAN PPPKARIDRA VPYPCPAAAG RDQKADGRMG  300
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-33171173103C-Myb DNA-Binding Domain
1mse_C2e-33171173103C-Myb DNA-Binding Domain
1gv2_A2e-33171173103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566355.10.0PREDICTED: transcription factor MYB44-like
TrEMBLI1HKE60.0I1HKE6_BRADI; Uncharacterized protein
STRINGBRADI2G28910.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.19e-49myb domain protein 70